SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013944424.1.32353 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013944424.1.32353
Domain Number 1 Region: 31-232
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 4.47e-53
Family DNA/RNA non-specific endonuclease 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013944424.1.32353
Sequence length 235
Comment endonuclease G [Simkania negevensis]; AA=GCF_000237205.1; RF=representative genome; TAX=331113; STAX=83561; NAME=Simkania negevensis Z; strain=Z; AL=Complete Genome; RT=Major
Sequence
MAKKTLGFFLGLAIGSSSVFVYDQMQHRGHPSGFPVLERMGYTMSYDTRAKIPFWTHERL
TKDSLEVHTERSGMDFKEDEEIYPLHRSQLCDYYQSGFDRGHHAPAANHRLSEEELRETF
LLTNISPQDAQFNRGLWAKLEKIIRILAKEADWVEVTTGPLFLAHDEADGRRLVTYQVIG
KNDVAVPTHFFKVINTPDRSWAYVIPNGPAKGSLSDYITPISEIEKLAGIRLTNL
Download sequence
Identical sequences F8L3T6
WP_013944424.1.32353 gi|338733976|ref|YP_004672449.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]