SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013971636.1.23948 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013971636.1.23948
Domain Number 1 Region: 14-135
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000235
Family SMI1/KNR4-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013971636.1.23948
Sequence length 138
Comment MULTISPECIES: aminoacyl-tRNA synthetase class I [Pseudomonas]; AA=GCF_000510285.1; RF=na; TAX=1435044; STAX=76759; NAME=Pseudomonas monteilii SB3078; strain=SB3078; AL=Complete Genome; RT=Major
Sequence
MLDLEGSESSIDVGDFSEIETLANGKLPILFKEIYLRNNGGFPRITEVEGDEYVFSINGF
NSVKFGELPIEKLMQEYNAQDKALHGYVPFAYDDGGNSFMLSLREEDAGTVYLLIQDGLQ
MERVCASFDDFVNSLSIG
Download sequence
Identical sequences A0A0C1KBW8 F8FTA6 V7D698 V9UUR7
gi|339486540|ref|YP_004701068.1| gi|568186462|ref|YP_008958994.1| WP_013971636.1.23948 WP_013971636.1.28354 WP_013971636.1.56258 WP_013971636.1.7435 WP_013971636.1.80759 gi|568181031|ref|YP_008953565.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]