SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013994001.1.951 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013994001.1.951
Domain Number 1 Region: 1-129
Classification Level Classification E-value
Superfamily PHP domain-like 0.00000000000000824
Family PHP domain 0.01
Further Details:      
 
Domain Number 2 Region: 232-367,508-608
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000017
Family ABC transporter ATPase domain-like 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013994001.1.951
Sequence length 670
Comment histidinol-phosphatase [Zobellia galactanivorans]; AA=GCF_000973105.1; RF=representative genome; TAX=63186; STAX=63186; NAME=Zobellia galactanivorans; strain=DsiJT; AL=Complete Genome; RT=Major
Sequence
MKKIDFHIHTVQSVSDRHFEFDIESLQEYVNLLKIDCIAITNHNLFDKIQFEEICKKLEI
KVFPGIEIDLEGGHLLLISENDILDDFALKCQKVKDLIPTKDDSINYEQLIDIFPNLKDY
LLIPHYDKKPNIKPITLEKLGDNIIAGEVTSLRKFKTCIKEADKLTPLIFSDCRFVENMS
SYPTRQTYVDVEETTLNAIKGCLYDKTKVFLSEEDGNDFFQATDDGIMLSTSLNVIVGGR
SSGKTYTLDKICENFDNVKYLRQFSLLQNDKENFKKLVTTRHSLVTENYLKEFKDVVLDV
NEIDLKSNEISLDKYLISLKKYASETNNLDTFSKCKLYNETKFTLDSLENLKKLISATET
LLETNEYKDIVNKHATDISLKNLAIELIQKYNELYEQNLKKDWTNNLIESIKDSLKFRST
TTSIEEVDFSKIQSEKIKVEKFIKLVKNVQSEKIIDSKEIRGFKVLAKTKQYTGAGQLKK
KSKTNLRFSDAFNNYENPYKFLISLQNVGIEETEFYKYFVDIDYRTLNKHGYEVSGGERS
EFNLLHEISDALKHDLLLIDEPESSFDNIFLKSEVNELIKEISKEIPVIVVTHNSTIGAS
INPNHLVFTQKTVNAGNVDYKVFFGHPTSKILKSVGGETIKNLDVLLNCLEAGEDAYNQR
NITNYEILKD
Download sequence
Identical sequences G0L6A2
WP_013994001.1.951 gi|340618631|ref|YP_004737084.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]