SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014012716.1.67626 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014012716.1.67626
Domain Number 1 Region: 31-221,252-290
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.83e-23
Family Terpene synthases 0.022
Further Details:      
 
Domain Number 2 Region: 310-515
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.84e-18
Family Terpene synthases 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014012716.1.67626
Sequence length 741
Comment hypothetical protein [Thermococcus sp. 4557]; AA=GCF_000221185.1; RF=na; TAX=1042877; STAX=1042877; NAME=Thermococcus sp. 4557; strain=4557; AL=Complete Genome; RT=Major
Sequence
MKKVLAAIMIVLMLIPAVGAGKIDGSVTFLSGASQSTKETREVSLALMALVSARDDVNWD
ITPDIDALVDELLDNQNQDGGWGHYFNEPSNVLDTAYAVIALTRAYPLMDVWKARDVERA
IDSGIDYLLSAKEENGWGYIPGTPVSCYPTVVALWALGENGYTYNSRTVRDAVRYLESIN
ASSCEISNYEFLALRVVAYHSTGYPLGSDVADQLKDILLKERMEVKERAMLTYALVLVSP
LDLDVARALKMLEKEGRSSDDIFYWMNTPSLMSQTEIIASTAFALMALSHPLKVTIPGEV
TNPYTMPCRELKYMQNLDGGWGLVLNEPSNEKATYYALLGLEKCYPTNESISKALEWARN
AFERDALWVQKNGRMSVGYYYALETLLRYNLLSEEEKASAVELIRNAQLDYGLWGNTVLG
PQPYETALAVKALLDLGVPANDPLIQAAKEWLLSISNGGWGTHVTTPHFSYMLKPDVLTT
ITVLEALENVATPEELEPHLQWLMDQRINGGWAYWKAYYVWQENREYPGTPSVELTVRAT
DMLLRYGHNYTSKTLDFVMNARDSGLIRNKPIETANAVLYLCRFQYIPPVSLNDVRAELD
SDIFEVIAPGMDNESVAEIVNRLSDTFSGGFIAANGTGIGEGSYIVLSNFSGYSIRVYNP
YLPFHIDGDNVTVGNVTVPLNKSVVLIPGKTPEGVVLFVFYEPENEGIAKDVFTTGFIKY
IGGSAMVLVVENGRIKVIAVG
Download sequence
Identical sequences G0HJA4
WP_014012716.1.67626 gi|341582218|ref|YP_004762710.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]