SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014020088.1.78327 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014020088.1.78327
Domain Number 1 Region: 49-341
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.27e-29
Family Cystathionine synthase-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014020088.1.78327
Sequence length 407
Comment selenocysteine synthase [Cyclobacterium marinum]; AA=GCF_000222485.1; RF=representative genome; TAX=880070; STAX=104; NAME=Cyclobacterium marinum DSM 745; strain=DSM 745; AL=Complete Genome; RT=Major
Sequence
MISRRKLLKRLGTLPLAGGVLGAGVPLSVVKGETIEEAPKRNVIEELGLRSFINAAGTYT
AMTASLMPDEVMQTINFSSDHYIMLDEVQDKVGEKIAALCHAEYATVTAGCWSAMVLGTA
GVLTGKDKKKISQLPDLTGMKSQVIVQKSHNTGYVHALTNTGVEIVEVETAADVDRAVND
KTAMMWFLNYQGPSGKIKHEEWVALAKKHGLPTMIDMAADVPPVENLWKYNDLGFDLVCV
SGGKAIRGPQSAGILMGRRDLVEAARLSAPPRGGTIGRGMKVNKEEILGMYVALDTYIKK
DHDKEWKEWEDKIALISDAVSEIESVSTDVSVPPVANHTPYLEIGWDPAKIKLTQAELRE
KLRDGSPSIEVIGGGEHAVKLTVFMLRPKEEKIVAKRIAEELIKAKA
Download sequence
Identical sequences G0J144
WP_014020088.1.78327 gi|343084729|ref|YP_004774024.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]