SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014026250.1.63292 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014026250.1.63292
Domain Number 1 Region: 7-162
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.67e-31
Family GHMP Kinase, N-terminal domain 0.00014
Further Details:      
 
Domain Number 2 Region: 182-296
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.75e-19
Family Homoserine kinase 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014026250.1.63292
Sequence length 318
Comment homoserine kinase [Pyrolobus fumarii]; AA=GCF_000223395.1; RF=representative genome; TAX=694429; STAX=54252; NAME=Pyrolobus fumarii 1A; strain=1A; AL=Complete Genome; RT=Major
Sequence
MVQHNRVRVKAPASIANLGPLFDLAALAIDYAYDVVEVEVVEELGDGIRVDVEAAGAPSG
EANTAYTAAYKILEYLGETLHLRIRVVKGVPPRMGMGGSGASAAAAAYAVNLLLGEPFTK
EELVKFAGEAEAVAAGTPHYDNVAASLLGGLVILLDRSRPWVARLNIPEDVYIILFIPKR
EVVKVPPGKGKTEVMREVLPREIPLATSIAWMEKALALTLGLQLDPYTALKAANYGGPVE
EARSKLIPGYAEAKREALEAGALAFNISGAGPTLFAIVREGDEDEVARRVAKILEKHWGE
LETRVVNIDREGARITSE
Download sequence
Identical sequences G0ED14
gi|347523255|ref|YP_004780825.1| WP_014026250.1.63292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]