SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014026338.1.63292 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014026338.1.63292
Domain Number 1 Region: 6-45,182-390
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.45e-26
Family FolH catalytic domain-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014026338.1.63292
Sequence length 568
Comment peptidase M28 [Pyrolobus fumarii]; AA=GCF_000223395.1; RF=representative genome; TAX=694429; STAX=54252; NAME=Pyrolobus fumarii 1A; strain=1A; AL=Complete Genome; RT=Major
Sequence
MQLNVRQVLERLAGFGEAVAGSEEARALSEELARLVEEVTGTAPRVVRFPVATWRDEGAI
VECGGLRLEARVLPQTLGGIEAGRLVEVHCTTPRCFQHVSPGDVVVARLPEDPDDVTTLY
VHALEAGASALIVYDRWPGRFRRIVVSGRWDYAWLPSPAPMPAVHMRAEDGSKLVKLCTG
MRVRVEASASIREGQGRTLELLLNEGEEREIIIMAHYDHWLSGAGDNLAGVVSLLEALRV
IRGEGVKGFTLRALLLDAEEFGDPMLPAWYWSYGSRWYAKMLSDTELLDQVVLALNLDLP
VLRRLKLAATPEVRGLVERLASNTLEFDVEEFETCYSDGYQFAKLGVPSATLYNVEDYVE
WYHTDADTPSVPDEVAIIEAGRLAGRVALEAGRLGPKALDYRGYIRVLESIAHEAPLEYR
RGVYMLSEEARLALEREDYDGLHRAFRLVNMTLGHCVFLGDYKWDSGGFRAMLAPRLRVV
LEEFRRVLDKRVGGPGDVVIPGVEDHLAVALPQPVKLWVYKRGAALTRQFWEALESAFKH
AVVDAARSVAEALVEAYEVLRARRETAR
Download sequence
Identical sequences G0EDH6
gi|347523343|ref|YP_004780913.1| WP_014026338.1.63292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]