SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014027030.1.63292 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_014027030.1.63292
Domain Number - Region: 31-60
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0374
Family Classic zinc finger, C2H2 0.038
Further Details:      
 
Domain Number - Region: 15-45
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0801
Family Rubredoxin 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014027030.1.63292
Sequence length 88
Comment hypothetical protein [Pyrolobus fumarii]; AA=GCF_000223395.1; RF=representative genome; TAX=694429; STAX=54252; NAME=Pyrolobus fumarii 1A; strain=1A; AL=Complete Genome; RT=Major
Sequence
MALQWEPQWEELVIEKWGVKLKVKKDKVTGMYACPICGISDSAIYFFSIEDLLRHMLTHA
RRERIETIRVSIEEGEEGAKLEEIGEES
Download sequence
Identical sequences G0EHK0
gi|347524035|ref|YP_004781605.1| WP_014027030.1.63292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]