SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014061762.1.85068 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_014061762.1.85068
Domain Number - Region: 88-163
Classification Level Classification E-value
Superfamily Prim-pol domain 0.00307
Family Bifunctional DNA primase/polymerase N-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014061762.1.85068
Sequence length 293
Comment DNA primase [Streptomyces violaceusniger]; AA=GCF_000147815.2; RF=na; TAX=653045; STAX=68280; NAME=Streptomyces violaceusniger Tu 4113; strain=Tu 4113; AL=Complete Genome; RT=Major
Sequence
MTSTHLATLPPLRTALELAAAGLPVLPLRRGKVPFGNCRTCAKDARTGRAVCGGRPNMKE
AGPCQCPGPCHAWAATTTDPSVIASPAWASAWREAVTVAYHPGGAGLTVVDLDDTAALAW
ARQTLPATRIVPTTRGEHWIYQGAMRSVNAVRDGVDIKSTMAYARWLGPGTGTITALPDI
VRALAVKKPSTGRSAPQSIAMPAWAAGEGVCPHRTPAYLDRGIAMAEQRITEARSAVHTT
VYRTFLAVLSTHGRCGCLTEAHITRLFTAAQAKGESPRHCTDAWTNARTTLGL
Download sequence
Identical sequences G2P9I8
gi|345016234|ref|YP_004818588.1| WP_014061762.1.85068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]