SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014107572.1.47640 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014107572.1.47640
Domain Number 1 Region: 39-110
Classification Level Classification E-value
Superfamily Coronavirus S2 glycoprotein 0.000068
Family Coronavirus S2 glycoprotein 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014107572.1.47640
Sequence length 220
Comment DNA repair ATPase [Glaciecola nitratireducens]; AA=GCF_000226565.1; RF=representative genome; TAX=1085623; STAX=300231; NAME=Glaciecola nitratireducens FR1064; strain=FR1064; AL=Complete Genome; RT=Major
Sequence
MPRFFVLRSLFCLCFLSLTACQSAVDGAYYGMWEKLGVEKRDILVDRVEDAQDSQKDAQE
QFASALDEFSSLINFDGGELEDIYNNLSDQLEASKESAASVTRRIDKVEGVANALFVEWE
AEIDMISSANLQRDSKRKLAETRRKYATLLVSMRKVEKSMAPVLVALQDNVFALKHNLNA
EAIGALQGEFNSIKQDVSSLIKEMNVAIAQSDDFIKSIRN
Download sequence
Identical sequences G4QJN5
gi|348028002|ref|YP_004870688.1| WP_014107572.1.47640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]