SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014164810.1.70420 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014164810.1.70420
Domain Number 1 Region: 63-290
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 8.24e-59
Family DNA/RNA non-specific endonuclease 0.00000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014164810.1.70420
Sequence length 297
Comment DNA/RNA non-specific endonuclease [Flavobacterium columnare]; AA=GCF_000240075.2; RF=representative genome; TAX=1041826; STAX=996; NAME=Flavobacterium columnare ATCC 49512; strain=ATCC 49512; AL=Complete Genome; RT=Major
Sequence
MKNLKRLTCLILACQTLVFCSREEELSSNTEILKAENLRKIQKASSTDNGDLLLGNPSNA
NQEDVNNYLASKNNYVISYNNKKGTANWVSWHLDYRNFGTADRANDFRSDNTLSSSNFFL
VSPNHYKDSGFDRGHMCPSADRTNTFQANSETFLMTNMVPQSPKNNQQTWGGFEERLRQF
VRNDKKEVYIVAGVYGQGGTGKKGGITTFLANGKICVPATTWKVALLLDEGTDDLKRISA
TTEVIAIEVPNNQNIDKDWKKYIVKVSDLETKTGYKFFSELNEGIAKSLKSKLYSGK
Download sequence
Identical sequences G8X5B6
gi|365959753|ref|YP_004941320.1| WP_014164810.1.70420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]