SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014174665.1.9551 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014174665.1.9551
Domain Number 1 Region: 18-266
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-54
Family Protein kinases, catalytic subunit 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014174665.1.9551
Sequence length 633
Comment serine/threonine protein kinase [Streptomyces bingchenggensis]; AA=GCF_002154605.1; RF=na; TAX=476552; STAX=476552; NAME=Streptomyces milbemycinicus; strain=NRRL 5739; AL=Scaffold; RT=Major
Sequence
MRPGGKVGKYRLTKGPVNGGRGAVWFAVDTELDRPVVLKRTLAENNSRAAFDELLAEARA
LAKFSHPNVVTLYGAERAGWGPKATFWLVMEHVTGGSLNGTARLPAKLAAHIGAQIANAL
AALHTKGIVHCDVKPHNVVITEDGVAKLADFGAAYRIDGSTTNTPSGSFSLTPAYAAPEA
FQGAPERASDLFSLGATVYALVTGEAPPRGPRRTIRTEALGDLVEDGPLREVLTALLQRD
PGRRPGAEEAQRALAEVAGPVDQLPRVPLEEVTKPYPPPEGPGEHSEHAAAGAARLPSLL
RRRPLLTGGTAATVVAIAAVATVLGLHDGDGGGPPAHADESPTATPTATAGGGFGLGDPR
TVDPCALLSTGSFERFGHHAQLDPQYGNYDRCDVVLSSDDDDIVDVTVDLDTEDPPSAAV
TRTSGKVGVVTEPAESGWCGRTLVLSGVRDTVIRVAVKLTEDVKAPLCDIADAAVEHAVT
VLNRGEVPRRSPKLPADSLAQQDACGLLNGRELEVVPGIDARDPDVGFGRWTCDWASTTN
RMTVRLAFDQGILSIPDNARFTELAGHDAVVMPEYEGDGSCTIDVFDRPYRSRDDRPTER
LRLEVGGARAKDRPSCETATDLARSATAALSAG
Download sequence
Identical sequences D7BRM3
WP_014174665.1.69245 WP_014174665.1.9551 gi|374984822|ref|YP_004960317.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]