SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014174989.1.69245 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014174989.1.69245
Domain Number 1 Region: 5-39
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000267
Family Protein kinases, catalytic subunit 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014174989.1.69245
Sequence length 59
Comment hypothetical protein [Streptomyces bingchenggensis]; AA=GCF_000092385.1; RF=representative genome; TAX=749414; STAX=379067; NAME=Streptomyces bingchenggensis BCW-1; strain=BCW-1; AL=Complete Genome; RT=Major
Sequence
MTDRDLLGGRYRLLRKIGLGGMGVVYEALDSTLDRRVAVAADWPICSRSPVTTSRRAKC
Download sequence
Identical sequences D7BWW6
WP_014174989.1.69245 gi|374985147|ref|YP_004960642.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]