SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014176005.1.69245 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014176005.1.69245
Domain Number 1 Region: 38-294
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000000000306
Family APH phosphotransferases 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014176005.1.69245
Sequence length 314
Comment kinase [Streptomyces bingchenggensis]; AA=GCF_000092385.1; RF=representative genome; TAX=749414; STAX=379067; NAME=Streptomyces bingchenggensis BCW-1; strain=BCW-1; AL=Complete Genome; RT=Major
Sequence
MVSAPQPGGPEAAPITLPQRLLDSLSNDPQSPARVWLAKLPELVAHQLRGWELTLERVPS
PGGRSSLIVLVRQADGTPATLKFPAPGPYAGHERAALAHWNGWGAVHLLRDDPESGALLL
ERLHSAVSLRSLPEAKALLEAAGTVRRLWVPPAEGHPFDSVATRTGKGVETLRLIAAGTW
AADARPLVDEALELREELSGQTPEHLLLHGDFRQGKVLAGERAPWLAVGPTPLVGERAYD
LAQLVLDRCEDLAAGSGPAAAARRRVAKLADSLDVDRDRLRGWTLFRAVEAGLRHAAVGD
RRRGELLLEFAGWL
Download sequence
Identical sequences D7CAH1
gi|374986164|ref|YP_004961659.1| WP_014176005.1.69245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]