SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014177369.1.69245 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014177369.1.69245
Domain Number 1 Region: 36-291
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.01e-62
Family Protein kinases, catalytic subunit 0.0000283
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014177369.1.69245
Sequence length 520
Comment serine/threonine protein kinase [Streptomyces bingchenggensis]; AA=GCF_000092385.1; RF=representative genome; TAX=749414; STAX=379067; NAME=Streptomyces bingchenggensis BCW-1; strain=BCW-1; AL=Complete Genome; RT=Major
Sequence
MGGSEMPVPDGPSAEGPLPGPSRAPDGVAPPAAGDPAHIGSFRLVGRLGAGGMGRVYLGV
SRAGRPTAVKVVRADLAEEPAFRRRFAAEVAAARRVQGPYTPAVVAADPDAELPWLATSY
IAGPSLGETVDDGGPLAPPMARRLGAGVAEALGAIHAAGMVHRDLKPSNVLLAADGPKVI
DFGIAAAADATRLTSTGVRLGTIGFMSPEQADGRPITPASDIFALGCLLAYAVTGRPPFG
DGPPSEVLYRVINAEPDPDHLDCGDPELSVLIGRCLRKWPADRPTVDEVIDACATREGQP
PGWPDARLGPRIAGAHAALERALSRGPSGDSGGSGSGRPVAEDRTAKGRGAWRSRRGAMA
GALLGVAAVAVVIAVVLTTSGDEDGGGARYTAGYKGRTLTLPDYDHYIDLPTGKVVKGDG
RWMLSTNSGGDGHGAFELQDATEAQVAGERSVTPERCAELVAHRPLLEKVRFAQAPAGRW
FCMRDRISGDVAVVQVLDTDSGDYTVTVAVDYYRRGAATG
Download sequence
Identical sequences D7BZG3
WP_014177369.1.69245 gi|374987535|ref|YP_004963030.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]