SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014180315.1.69245 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014180315.1.69245
Domain Number 1 Region: 5-263
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.36e-76
Family Protein kinases, catalytic subunit 0.00000303
Further Details:      
 
Domain Number 2 Region: 439-694
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.02e-38
Family Quinoprotein alcohol dehydrogenase-like 0.00031
Further Details:      
 
Domain Number 3 Region: 353-484
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.84e-24
Family Quinoprotein alcohol dehydrogenase-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014180315.1.69245
Sequence length 700
Comment serine/threonine protein kinase [Streptomyces bingchenggensis]; AA=GCF_000092385.1; RF=representative genome; TAX=749414; STAX=379067; NAME=Streptomyces bingchenggensis BCW-1; strain=BCW-1; AL=Complete Genome; RT=Major
Sequence
MASRVLGGRYELVAFVGRGGMGEVWEGRDRVIQRRVAVKLLPHDRRDTSSAELFFREART
AGSLNHPGVVTVFDLGQDPDDGTLYLVMEFVTGRDLDTVLREDGPPQVPAAVDWAAQTAA
ALQAAHAAGVVHRDLKPANLMLTPDDQVKVLDFGIARYIASTHKSSKVIGTLAYMPPERF
GDLPADARSDLYSLGCVLHELLTGSTPFQTTEAAAMMAAHLNTTPKPPGRARPGIPAALD
DLVMALLAKDPDHRPASAAEVCQRLRELSATPTTPGTGTHLPGTGTGTKTVTTTAPLTVA
GPGTAHMSEPEQVPAAGTPTPAGRISRRAALRLGIGAAVVVGVGTAAALTLSDDNTPDPR
LRWRFTTGKAVSSSPTVVDGVVYIGSADKNVYALDAATGDKKWAYPTGGMVEAAPTVVDG
VVYVGSHDNSMYALDAATGKRKWAYATGDMIDEAPTVVDGVVYVSGNSDVFALDAATGDK
KWAYTVGDNDFYSTPAVVDGVVYVGSYDAVYALDAATGDKKWEFRPDRKSFRSPTVVEGV
VYIGSGSYDADKDGSGGSVFALDAATGDKKWEFRLDREFDSSPAVVDGVVYTGGYNYVVE
SGSSDGEVFALDAATGDKKWEFPTGDLIRSSPTVVDGVVYIGSFDNNVYALDAATGNKKW
AYATGYRVQSTPAVVDGVVYVGSQDRNVYALNATIKDSPA
Download sequence
Identical sequences D7CD18
gi|374990501|ref|YP_004965996.1| WP_014180315.1.69245 WP_014180315.1.9551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]