SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014181224.1.9551 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014181224.1.9551
Domain Number 1 Region: 16-319
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.69e-49
Family APH phosphotransferases 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014181224.1.9551
Sequence length 348
Comment phosphotransferase family protein [Streptomyces bingchenggensis]; AA=GCF_002154605.1; RF=na; TAX=476552; STAX=476552; NAME=Streptomyces milbemycinicus; strain=NRRL 5739; AL=Scaffold; RT=Major
Sequence
MTCSTPLADTTNPPGLELGALSRWFGANVPACQGPLAAAVLHGGRSNLTYLVTDGHSRWV
VRRPPLGGLTPSAHDIGREFRVMSALRATGVAVPGTVAHCTDQDVTGAPFTVVAYVEGRV
LRSRADTAGLTPYDLGRCADGLVEQLARLHALSYTEAGLSGWGRPEGYLRRQLDRWRTQW
DLVATRQLSELPRLHKALEDALPRESDASIVHGDFRVDNTILDPTDLSRVRAVVDWELST
LGDPLADLGTFLAYRDPAVDALLDSPAATDPGFPGPFELAELYALLSGRDITLLPFYQAL
AYFKIAVIAEGVYARHLQGVTVGEGFAGAGASVPELVKAGLALLGRRR
Download sequence
Identical sequences D7BW65
gi|374991411|ref|YP_004966906.1| WP_014181224.1.69245 WP_014181224.1.9551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]