SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014182456.1.69245 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014182456.1.69245
Domain Number 1 Region: 179-437
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.72e-63
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 3-121
Classification Level Classification E-value
Superfamily SMAD/FHA domain 5.36e-22
Family FHA domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014182456.1.69245
Sequence length 454
Comment serine/threonine protein kinase [Streptomyces bingchenggensis]; AA=GCF_000092385.1; RF=representative genome; TAX=749414; STAX=379067; NAME=Streptomyces bingchenggensis BCW-1; strain=BCW-1; AL=Complete Genome; RT=Major
Sequence
MTPSATITLTLVEGRVKPGAYVFEERTTCVLGRSTDCSPQLPDDSDHKTVSRHHCLLDIN
PPDIRIRDFGSLNGTYVNGEKIGQRRRGLTPEEAVADSYPEHDLKDGDRIRLGDTVFRVD
ITRPQVATLRLARCAKCERELGDEAGGRPGELLCAACQARPDAVLKLLLELAHGGRADLM
AIRGYSVIRELGRGGMGAVYLARHEATGVEVALKVMLPKVAASETARARFLREVALTRAM
KHPHVVALHDAGFANGTFYLTTEFCTGGSLDRLVAERGGRLPVEEAVPIAVQALKGLEHA
HGQGVVHRDLSPSNILLHRETDGSTTAKIADFGIGKAFDQAGLSGLTRTGTTAGKPMFMP
RQQVINFRKATPAVDVWAFAACLYHTLTGRTPREFPRAKDPWQVVLQEPAIPIRRRDPAI
PRRLAEVIDTALREHPEIGCASAAELRGALERAV
Download sequence
Identical sequences D7CDG7
WP_014182456.1.69245 WP_014182456.1.9551 gi|374992645|ref|YP_004968140.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]