SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014231673.1.13071 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014231673.1.13071
Domain Number 1 Region: 88-220
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 8.95e-25
Family Glutathione S-transferase (GST), C-terminal domain 0.0003
Further Details:      
 
Domain Number 2 Region: 4-90
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.53e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014231673.1.13071
Sequence length 222
Comment maleylacetoacetate isomerase [Vibrio sp. EJY3]; AA=GCF_000241385.1; RF=na; TAX=1116375; STAX=1116375; NAME=Vibrio sp. EJY3; strain=EJY3; AL=Complete Genome; RT=Major
Sequence
MSEQITLYGYWRSSAAYRVRICLNLKEIQYESKSVHLVREGGEQHSEEYHKLNPSELVPV
LVDGELRLNQSLAIIQYLDENYPDVAVIPKRSPLRYQALSMAQDIAMEIHPLNNLRVLQY
LEGELACDAERKVAWIHHWINKGFSSLEEKLAAHRKTYGDCKFSLTDSPSIVDICLVPQV
YNALRFSVDLAAYPIINSIVEACYQLPAFIDAMPEHQPDANS
Download sequence
Identical sequences H2IBB1
WP_014231673.1.13071 gi|375265330|ref|YP_005022773.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]