SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014231884.1.14200 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014231884.1.14200
Domain Number 1 Region: 1-74
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000127
Family Thioltransferase 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014231884.1.14200
Sequence length 80
Comment MULTISPECIES: thioredoxin family protein [Vibrio]; AA=GCF_000438785.2; RF=na; TAX=1219067; STAX=691; NAME=Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759; strain=DSM 759; AL=Scaffold; RT=Minor
Sequence
MLTLYSTEGCHLCEMAFSLITEVGLAEQTDIVDIAFDDELFSRYGVTIPVLKYQDSELNW
PFDSEQLTNWLENNGITYHS
Download sequence
Identical sequences A0A1B1ECB9 H2ICR7
gi|375265541|ref|YP_005022984.1| WP_014231884.1.13071 WP_014231884.1.14200 WP_014231884.1.16983 WP_014231884.1.18931 WP_014231884.1.37005 WP_014231884.1.50333 WP_014231884.1.59672 WP_014231884.1.84506 WP_014231884.1.88247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]