SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014232522.1.13071 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014232522.1.13071
Domain Number 1 Region: 163-313
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.32e-37
Family Glutathione S-transferase (GST), C-terminal domain 0.015
Further Details:      
 
Domain Number 2 Region: 31-150
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.36e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014232522.1.13071
Sequence length 316
Comment MULTISPECIES: glutathione-dependent reductase [Vibrio]; AA=GCF_000241385.1; RF=na; TAX=1116375; STAX=1116375; NAME=Vibrio sp. EJY3; strain=EJY3; AL=Complete Genome; RT=Major
Sequence
MGKLVEGVWHDVWYDTKSSGGKFVREDAGFRNWIKNEPDAEFQPESGRYHLYVSLACPWA
HRTLIFRKLKGLEQHIDVTVVCPDMLSQGWQMGLPEPLFGHTRMHQIYTQAKPDYSGRVT
VPVLWDKKTNTIVSNESSEIIRMFNSAFNGLTGNEDDYYPEYLQASIDEWNDFIYPNVNN
GVYRCGFATTQEAYEEAFDSLFSALDKIDTHLATHRYLTGNQITEADWRLFTTLVRFDAV
YVGHFKCNKKRIADYTNIQGYLKELYQVDGVAETTDFYHIKRHYYFSHTGINPTQVVPKG
PDLDLESPHGREPLSN
Download sequence
Identical sequences H2IHE5
gi|375266183|ref|YP_005023626.1| WP_014232522.1.13071 WP_014232522.1.14200 WP_014232522.1.18931 WP_014232522.1.37005 WP_014232522.1.50333 WP_014232522.1.59672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]