SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014232522.1.14200 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014232522.1.14200
Domain Number 1 Region: 163-313
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.32e-37
Family Glutathione S-transferase (GST), C-terminal domain 0.015
Further Details:      
 
Domain Number 2 Region: 31-150
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.36e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014232522.1.14200
Sequence length 316
Comment MULTISPECIES: glutathione-dependent reductase [Vibrio]; AA=GCF_000438785.2; RF=na; TAX=1219067; STAX=691; NAME=Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759; strain=DSM 759; AL=Scaffold; RT=Minor
Sequence
MGKLVEGVWHDVWYDTKSSGGKFVREDAGFRNWIKNEPDAEFQPESGRYHLYVSLACPWA
HRTLIFRKLKGLEQHIDVTVVCPDMLSQGWQMGLPEPLFGHTRMHQIYTQAKPDYSGRVT
VPVLWDKKTNTIVSNESSEIIRMFNSAFNGLTGNEDDYYPEYLQASIDEWNDFIYPNVNN
GVYRCGFATTQEAYEEAFDSLFSALDKIDTHLATHRYLTGNQITEADWRLFTTLVRFDAV
YVGHFKCNKKRIADYTNIQGYLKELYQVDGVAETTDFYHIKRHYYFSHTGINPTQVVPKG
PDLDLESPHGREPLSN
Download sequence
Identical sequences H2IHE5
WP_014232522.1.13071 WP_014232522.1.14200 WP_014232522.1.18931 WP_014232522.1.37005 WP_014232522.1.50333 WP_014232522.1.59672 gi|375266183|ref|YP_005023626.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]