SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014232550.1.18931 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014232550.1.18931
Domain Number 1 Region: 1-104
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.66e-34
Family Thioltransferase 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014232550.1.18931
Sequence length 111
Comment MULTISPECIES: monothiol glutaredoxin, Grx4 family [Vibrio]; AA=GCF_001680025.1; RF=na; TAX=1219067; STAX=691; NAME=Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759; strain=ATCC 14048; AL=Complete Genome; RT=Major
Sequence
METIDKIKQQISENSILLYMKGSPKLPSCGFSSQASQALMACGEKFAYVDILQNPDIRAE
LPKYAQWPTFPQLWIEGELIGGCDIILEMFQKGELQPLIKEAAARAEGEAE
Download sequence
Identical sequences A0A1B1EDQ5 H2IHQ4
WP_014232550.1.13071 WP_014232550.1.14200 WP_014232550.1.16983 WP_014232550.1.18931 WP_014232550.1.37005 WP_014232550.1.50333 WP_014232550.1.59672 WP_014232550.1.84506 WP_014232550.1.88247 gi|375266211|ref|YP_005023654.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]