SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014233348.1.13071 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014233348.1.13071
Domain Number 1 Region: 3-106
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.43e-38
Family Thioltransferase 0.0000375
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014233348.1.13071
Sequence length 108
Comment MULTISPECIES: thiol reductase thioredoxin [Vibrio]; AA=GCF_000241385.1; RF=na; TAX=1116375; STAX=1116375; NAME=Vibrio sp. EJY3; strain=EJY3; AL=Complete Genome; RT=Major
Sequence
MSDKILQLTDDGFENDVINAAGPVLVDFWAEWCGPCKMIAPILDEVAEEYEGKLTIGKLN
IDHNAGTPPKFGIRGIPTLLLFKDGNVAATKVGALSKTQLKEFLDANI
Download sequence
Identical sequences A0A1B1EFX3 H2IFH0
WP_014233348.1.13071 WP_014233348.1.14200 WP_014233348.1.16983 WP_014233348.1.18931 WP_014233348.1.37005 WP_014233348.1.50333 WP_014233348.1.59672 WP_014233348.1.84506 WP_014233348.1.88247 gi|375267031|ref|YP_005024474.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]