SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014234309.1.88247 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014234309.1.88247
Domain Number 1 Region: 82-203
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.9e-24
Family Glutathione S-transferase (GST), C-terminal domain 0.0067
Further Details:      
 
Domain Number 2 Region: 1-87
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.66e-19
Family Glutathione S-transferase (GST), N-terminal domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014234309.1.88247
Sequence length 204
Comment MULTISPECIES: glutathione S-transferase [Vibrio]; AA=GCF_001680085.1; RF=na; TAX=691; STAX=691; NAME=Vibrio natriegens; strain=CCUG 16374; AL=Complete Genome; RT=Major
Sequence
MKLYETAMTPSCKRVNIFLKEIGGDVERVAINVRDGDNLTDSFKQKSVNGKVPVLEFDDG
TTICESVAICRYFDEEFSNDLNLFGGNQRERAQVEMWHRVVEFQGLYAAFQAFRNISAIY
KDRENCVKEWGEESKSRVLEFLPVLDKRLAESEFIATDRFTIVDITGYLFVGFAINALQI
DVLSTAPNIARWFEKISAREAFQS
Download sequence
Identical sequences A0A1B1EKP3 H2ILR4
gi|375263210|ref|YP_005025440.1| WP_014234309.1.13071 WP_014234309.1.88247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]