SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014238139.1.43509 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014238139.1.43509
Domain Number 1 Region: 121-301,337-525
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 7.19e-79
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.00014
Further Details:      
 
Domain Number 2 Region: 18-117
Classification Level Classification E-value
Superfamily Cytochrome c 6.45e-20
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014238139.1.43509
Sequence length 532
Comment cytochrome CBB3 [Azospira oryzae]; AA=GCF_000236665.1; RF=representative genome; TAX=640081; STAX=146939; NAME=Dechlorosoma suillum PS; strain=PS; AL=Complete Genome; RT=Major
Sequence
MKTRVQAARRPSSLAFWLLSVPLGLGALWLASRPAHAADANAPALFQQHCAACHGADRLG
GMGPALLPENLERLRKAEALKTIREGRAATQMPAFKDQLSEADIAALADYAYAPVNPKPT
WTEKDIRASRIQHVDEKTLSPRPVFKADPMNLFVVVEGGDHHVSILDGDKLEPIHRFQSR
YALHGGPKFSPDGRFVYFASRDGWLTKFDLWNLKVVAEVRAGINTRNAAVSGDGKYVMAA
NYLPQDLVLFDADLNLIKVMEAKSADGKESSRVSAVYDAAPRKSFVAAMKDMPEVWEISY
DPEAHPIYDGLVHDYQYKEGVSVPGFLNPRRTRLTDPLDDFFFDQSYSEVMGTSREGKGQ
VVNLDARRKVSELQLSGMPHLGSGITWNWQGRTVMASTNLKEGKVTVIDMKDWKPVKDIV
TRGAGFFLRSHENSRYAFVDSMMSPAKDTLQVIDKDKLEIVKELKPVPGKTLAHIEFTKD
GRYALASLWEMDGALIIYDARTLEEVKRLPMKKPVGKYNVWNKITRSEGTSH
Download sequence
Identical sequences G8QI56
WP_014238139.1.43509 gi|372489735|ref|YP_005029300.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]