SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014253988.1.85326 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014253988.1.85326
Domain Number 1 Region: 10-113
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 7.06e-42
Family N-utilization substance G protein NusG, N-terminal domain 0.0000384
Further Details:      
 
Domain Number 2 Region: 122-177
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.38e-17
Family N-utilization substance G protein NusG, C-terminal domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014253988.1.85326
Sequence length 177
Comment transcription termination/antitermination protein NusG [[Clostridium] clariflavum]; AA=GCF_000519985.1; RF=na; TAX=1045012; STAX=288965; NAME=[Clostridium] clariflavum 4-2a; strain=4-2a; AL=Scaffold; RT=Major
Sequence
MQIDDTPEGAKWYVVHTYSGYENKVKANLEKIVENRGMQDYILDIVVPMEEQIEIKDGRK
KATLKKVFPGYVLVKMIMTDESWYVVRNTRGVTGFVGPGSKPVPLSDEEVRMMGVEEFMP
VLDYEVGDNVRVATGPLENFIGVVEEINLEKRKVRVSVSMFGRETPVELELFQIQKI
Download sequence
Identical sequences G8LUL7
WP_014253988.1.34793 WP_014253988.1.85326 gi|374295090|ref|YP_005045281.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]