SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014254348.1.85326 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014254348.1.85326
Domain Number 1 Region: 502-655
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 3.14e-40
Family Cellulose-binding domain family III 0.0000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014254348.1.85326
Sequence length 655
Comment sugar-binding protein [[Clostridium] clariflavum]; AA=GCF_000519985.1; RF=na; TAX=1045012; STAX=288965; NAME=[Clostridium] clariflavum 4-2a; strain=4-2a; AL=Scaffold; RT=Major
Sequence
MNKVKNDGLESFGVILKVKKNSVIVMTDKLDFVELNRKPDMLRGQKIYFTSLDLCNSSLW
LLNSKKFLKFASAAASVAAVFAILFFGFRFLFLSNEYAYIDLDINPSIEITINRNENVLK
AEALNNDGQILLDAVKIKNMDLKDAVSLLLNKSREIGFIDSFNNKVILAAALNSSKVSES
QNKNINSMISSLKQIAEKSGVESQVIQLSYKDRKEAMENGLSMGKYYIYTKAKDEGIQIT
VEEVKNSNISTLLSKIDLSENTNDPQNPSADIEPTPEPIVQPSSSQMVASIPSVAAPTAT
DKTSHTFKPVATPEPSFISEHTPSPAATMVTEVVEPSITPDRAIITPHRTYYITSTPKPV
FSTTPTPSPRPTVNVTVTYRPSPVVTPTKTPTPRVIITNSPTFKPISTKFSTPTTKKTPT
PSVYTATPKITVIPSSKPSTPTSNPTPIISSKPTPISTLTFTPTPKITSTPIITTAPTPI
ITPSPTPKPTTAPTSTPIEQTSVKLGMYNEVRTDKAKEIHPRFKLINTGNTPIKLSTVKI
RYYYTIDIEDKQQVFYCDWSNIGRNSITGKLVKMNTGRNDADHYLEIGFDTDESLEPGSN
IEIICRIGPDNTIGDGNIFYNQLNDYSFNNSAGNFVNWDKVTVYISGNLVWGTEP
Download sequence
Identical sequences G8LXL9
WP_014254348.1.34793 WP_014254348.1.85326 gi|374295463|ref|YP_005045654.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]