SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014254351.1.34793 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014254351.1.34793
Domain Number 1 Region: 29-477
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 3.97e-169
Family Cellulases catalytic domain 0.00000000000928
Further Details:      
 
Domain Number 2 Region: 483-640
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 5.23e-41
Family Cellulose-binding domain family III 0.00001
Further Details:      
 
Domain Number 3 Region: 667-730
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000000628
Family Type I dockerin domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014254351.1.34793
Sequence length 732
Comment endoglucanase [[Clostridium] clariflavum]; AA=GCF_000237085.1; RF=representative genome; TAX=720554; STAX=288965; NAME=[Clostridium] clariflavum DSM 19732; strain=DSM 19732; AL=Complete Genome; RT=Major
Sequence
MKKLITFITVLSLMSTLLVPHSVTAAGSFNYGEALQKSIIFYEMQRSGRLPENNRVNWRG
DSGLNDGADAGLDLTGGWYDAGDNVKFNLPMAYTATMLAWSVYENRDAYKRSGQLGYILE
NIKWATDYFIKCHPSPNVYYYQVGDGHLDHAWWGPPEVMQMQRPSFKVTSDSPGSTVVAE
TAAALAAASIIFKETDPSYSATCLKHAQELFTFADTTRSDEGYKAANGFYTSHSGFYDEL
TWASAWLYLATKDSSYLDKARSYQSYWEKELGTNIIKYSWGHCWDNKLFGACLLLARETG
DSVYKQVIENNLDWWTVGFNGGRVQYSPKGLAVLDMWGSLRYATTAAFLADVYADWSGCD
SAKAKIYREFAKNQIDYALGSTGRSFVVGFGVNPPKYPHHRAAHGSWEAMMTTPSEHRHI
LYGALVGGPGANDAYTDSINDYQSNEVACDYNAGFVGILARMYDKYGGDPIPNFNAIEPV
GEEFVIYGALNASGPTFTNMKVTLANMTGWPPRGSDTLSFRYFVDISEVVNAGYKASDIT
VSASASNGAKVSPKLIEWDASKNIYYVEVDFTGTYIYPGGINEYKRDVYFSINAPNGFSG
LDNTNDFSFKGLDKASPQTGAKTEYIPIYDNGVKIYGMEPGEPAATPTKTVTPTPTPKET
PTATPVDFVKGDLNGDKTFNSIDYAYLKMHLLGMNKLNEAQLLAADVDNNGQVDSIDYAI
MKQVLLGIRKDF
Download sequence
Identical sequences G8LXM2
WP_014254351.1.34793 gi|374295466|ref|YP_005045657.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]