SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014254798.1.34793 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014254798.1.34793
Domain Number 1 Region: 125-275
Classification Level Classification E-value
Superfamily CYTH-like phosphatases 3.92e-26
Family CYTH domain 0.00012
Further Details:      
 
Domain Number 2 Region: 36-104
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.7e-17
Family Type I dockerin domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014254798.1.34793
Sequence length 281
Comment hypothetical protein [[Clostridium] clariflavum]; AA=GCF_000237085.1; RF=representative genome; TAX=720554; STAX=288965; NAME=[Clostridium] clariflavum DSM 19732; strain=DSM 19732; AL=Complete Genome; RT=Major
Sequence
MRKSKLAISTLFLSFSLLFNGFSVMAEQMKPIVDNFILGDINGDGYIDSNDYGMLKLYLL
GFIKDFSYKHGFQAADVNSDGNVNSIDFAIFKRYLLGMITDFPQTPIPTPFATPKPPVTQ
AEGYEIERKFLIDPNKIPYDLDFLDKYEITQSYISFSPEIRLRNVDGTRFYLTVKANVDS
NGLIREERNFWMTEEEYNNLFKKIEGNVIYKARYQGLDEHRRIFAIDIFKGDLEGLAYYE
MEFPNEELANSYIPPSWVGKEVTSDKRYKNGSLAQFGIPKD
Download sequence
Identical sequences G8M2S8
gi|374295925|ref|YP_005046116.1| WP_014254798.1.34793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]