SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014255764.1.34793 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014255764.1.34793
Domain Number 1 Region: 239-708
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 3.12e-94
Family Cellulases catalytic domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014255764.1.34793
Sequence length 742
Comment alpha-L-fucosidase [[Clostridium] clariflavum]; AA=GCF_000237085.1; RF=representative genome; TAX=720554; STAX=288965; NAME=[Clostridium] clariflavum DSM 19732; strain=DSM 19732; AL=Complete Genome; RT=Major
Sequence
MSKLWYTKPAGCWEEALPIGNGRMGAMIFGSIETEHIQLNEDSVWYGAFVDRNNPDALKN
LPKIRELIIKGQIPEAEELMVYALSGIPQSQRPYQSLGDLTIRFKGMEGDKSGYIRCLSL
DDAIHTVKVKVAENTYKRETFLSAADDVLVMRITSDGDKKISFSALLTRERFYDRVIKVG
QDAVMLDGNLGKGGLDFVMMLKAVAEGGSCDVVGEHLIVNDADAVTLLFTAGTTFRFQNL
KEQLKKILNDAANRSYDDLRKRHVEDYMSLYNRVSFELNGTEKYEELTTEERLKKAKEGE
VDKGLAKLYFDFGRYLLISCSREGSLPANLQGVWNKDMNPAWDSKYTININTQMNYWPAE
VCNLSECHKPLFDLIKRMVPNGQKTARTMYNCRGFVAHHNTDIWGDTAVQDHWIPASYWV
MGAAWLCTHLWMHYEYTQDKDFLKEAFPIMREAVLFFLDFLIEDKGYLKTCPSVSPENTY
ILPNGVQGSVTIGATMDNQILRDLFSQCIKAAEILRVCDQMNRDIEETVKKLEPTRIGSR
GNIMEWTEDYDEAEPGHRHISHLYGLHPSTQITVDGTPELAEAARRTLELRLAHGGGHTG
WSRAWIINLYAKLWDGEEAYKNLEQLISKSTLPNMFCNHPPFQIDGNFGGTAAIAEMLVQ
STEQRIVLLPALPKVWKNGSIKGLCVRGGAEISLHWQDCELTKCIIKAKHKIQTDVVYKQ
KRIKISLEAGEEAVLAFSHSFF
Download sequence
Identical sequences G8M1I9
gi|374296937|ref|YP_005047128.1| WP_014255764.1.34793 WP_014255764.1.85326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]