SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014256134.1.85326 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014256134.1.85326
Domain Number 1 Region: 212-519
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 7.85e-70
Family alpha-L-arabinanase-like 0.0018
Further Details:      
 
Domain Number 2 Region: 59-192
Classification Level Classification E-value
Superfamily AbfB domain 1.12e-42
Family AbfB domain 0.00014
Further Details:      
 
Domain Number 3 Region: 534-605
Classification Level Classification E-value
Superfamily Type I dockerin domain 3.04e-17
Family Type I dockerin domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014256134.1.85326
Sequence length 609
Comment glycoside hydrolase [[Clostridium] clariflavum]; AA=GCF_000519985.1; RF=na; TAX=1045012; STAX=288965; NAME=[Clostridium] clariflavum 4-2a; strain=4-2a; AL=Scaffold; RT=Major
Sequence
MKKRLVKICVLVMVTAALVCCTINFSAEIILAVDFNTMLDGYNSMGTMQLLSTDSETSKI
RLQSYNYPSMYIRHNNFIARIDEKVSPEEDAQWRLVKGLANQGEGYVSIESVNYPGYYLR
HYDYKLRLEKNDGSSIFAADATFKVVQGLADTSCISFQSYNYPTRYIRHYEKLLRIDEIV
TDLDRMDATYRLFDDSVVLPDPNEPEGAVIVTNPVVIQRADPWVYRHTDGYYYMTASVPE
YDRIELRRAKTIQGLASATPKTIWRRPSSGVMGGHIWAPEIHFIEGKWYIYFSAGTSSNK
FDIRLYVLECADSNPIDGTWIERGQLKTNWESFTLDATTFEHNGVRYLVWAQKDPNIDSN
SNIYIAKMNGPFAITGKQVMISTPEYPWEKVGYKVNEGPAVIKKNGRIFITYSASATDSN
YCMGLLTASDTSNLLDPNSWKKSPSPVFQSNDSTGQYGPGHNSFTTSPDGKVDIMIYHAR
NYKNIIGDPLYDPNRHTRAQRVDWNDDGTPNFGIPVADGRIEIYIPPTDIPDPINFIYGD
LNGDKAVNAIDYALMKRILLGMSGELLSDDWEKAADLNMDGSINSIDFALLKKYLLGMLK
TLPYTNTAL
Download sequence
Identical sequences G8LV12
WP_014256134.1.34793 WP_014256134.1.85326 gi|374297322|ref|YP_005047513.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]