SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014256287.1.34793 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014256287.1.34793
Domain Number 1 Region: 38-297,370-428
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.72e-87
Family Type II chitinase 0.0000144
Further Details:      
 
Domain Number 2 Region: 431-492
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000000608
Family Type I dockerin domain 0.001
Further Details:      
 
Domain Number 3 Region: 289-361
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.000000733
Family Chitinase insertion domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014256287.1.34793
Sequence length 493
Comment chitinase [[Clostridium] clariflavum]; AA=GCF_000237085.1; RF=representative genome; TAX=720554; STAX=288965; NAME=[Clostridium] clariflavum DSM 19732; strain=DSM 19732; AL=Complete Genome; RT=Major
Sequence
MKRNIGKAFLSLLIISAIALEVLMFLQFSTVKGQIVKQSIVYFPNWAVYLDSHNYFAVGD
IPWDKVTIVNHAFFKINDKYEIETTDRYADFEKSFPHSSGSLKGHFGEYKYYKSLYPNVK
LVVSIGGWTESGKFHEMAMTTSGRAAFINSIISFLKTYTFFDGVDIDWEYPGVTRDGCPG
GPEDRQNFTNLLKEIRQAYIDNNMPDKLLTIAVSPSKYTTSHTDPNNYAQYVDFINVMTY
DMHGEWDSITNHHSPIYAKDDYSVDGAFKLYTETYGVPANKIVIGTPFYSRGWSNVIASE
KHGLGVSGLGYLQGTLGSNGQNAYFRMKELEAMTDVYVKYWDDYARVPWLYSAALHEMYT
YEDERSLAERCDYVIDNNGGGIMVWTVAFDDKDKGFPLMSIIADKLGIGGDSVQTPTATI
MPAGTPTPASTILKGDINGDGEINSIDFAYLKKYLLGMNVPFTNILETADLNNDNSVDSI
DYALLKCLILGIK
Download sequence
Identical sequences G8LWA7
WP_014256287.1.34793 gi|374297487|ref|YP_005047678.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]