SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014263718.1.98070 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014263718.1.98070
Domain Number 1 Region: 66-164
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 4.08e-32
Family Sigma2 domain of RNA polymerase sigma factors 0.00033
Further Details:      
 
Domain Number 2 Region: 172-254
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 4.67e-16
Family Sigma4 domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014263718.1.98070
Sequence length 256
Comment RNA polymerase subunit sigma-24 [Granulicella mallensis]; AA=GCF_000178955.2; RF=representative genome; TAX=682795; STAX=940614; NAME=Granulicella mallensis MP5ACTX8; strain=MP5ACTX8; AL=Complete Genome; RT=Major
Sequence
MSVVEAIVLPGETSRRRPSPFALGLQQAPGSAAEVKSAAGMPKAAAQPGTRAKLSTEQLE
ARQQQRAEDDELIRAAQKGDRAAFDTLVRRYDRSVLRLALHVLGNEQDAQDVHQDAFIKA
YRHLSNFRFECSFYTWLYRIVTNLCLDQLRRRKSRREDPSTVLDSSGDEIDLLANLQDGR
AMANPARELERKGMNEAIQSALAELTPRERTVFELKHYQGLKLRTIGEMLSTTEETAKNT
LFRATRKLRARLADVR
Download sequence
Identical sequences G8NPB4
WP_014263718.1.98070 gi|374309434|ref|YP_005055864.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]