SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014264153.1.98070 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014264153.1.98070
Domain Number 1 Region: 343-376,416-709,736-781
Classification Level Classification E-value
Superfamily Kelch motif 0.0000000157
Family Kelch motif 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014264153.1.98070
Sequence length 782
Comment hypothetical protein [Granulicella mallensis]; AA=GCF_000178955.2; RF=representative genome; TAX=682795; STAX=940614; NAME=Granulicella mallensis MP5ACTX8; strain=MP5ACTX8; AL=Complete Genome; RT=Major
Sequence
MRICNRLGVFTLFATALISVVGCGGKGGGGNSTTTPPPPATYTIGGTISGLTATGLVLQD
NGGDSLTVGANASSFTFATPITSGGAYSATVLTQPAGLNCTVTSGSGTASANVTTVSIVC
VQAYTIGGSVFGLSGTGLVLQDNGGNNLTVGASAKSYAFVFPNTIPSAGVPYSVTVLSDP
AGQSCTVAGPIGTAKASVTNVDVSCTANSSASYIISGTVTGLKGAGLILQDQAGVNDNDL
LPVDANGNFTFVDPIPAGGTYNVTVLTPPPGRHCVITNGTGAPIADVSNVSVVCLGEWTW
IGGNNIVGSNGEQPGVYGTLGTPDPANIPGGRQQELTWTDSTGKFWLFGGYGEDSTGVGF
GGQLNDLWRFDPALGTAGEWTWMGGSNVTPPSTSLGAAGEPGSYGTLGVTSPLNNPGGRE
QVASWLDASGSLWLFGGEGIDETGGTGQLNDLWKFDPTKGPTGEWTWLGGNSHVPFVFGG
QIGVYGAPGTPDPANIPGGRYGSMTWKDASGNFWLFGGQGTDVAGTQGYLNDLWQYAPST
GEWTWMGGSSSIGDSQGQSGTYGTQGTPDPTNIPGGRDAGVTWTDASGNFWLFGGLGIDA
AGNLAYLNDLWKYTPSAIGNTGQWTWMGGGTTAPQAYSGLSGVYGVQGTADPANIPGGRY
SAISWTDASGMFWLFSGSGYDSIGLQGSLNDLWKYTPSVTGDTGQWTWMGGSTIVGHAQG
QGQSGIYGMLGIAGSNNNPGGRFGSASWIDSTGNLWLFGGDGFDSTLTGMQGNLNDLWKY
QP
Download sequence
Identical sequences G8NUB5
WP_014264153.1.98070 gi|374309871|ref|YP_005056301.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]