SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014267635.1.98070 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014267635.1.98070
Domain Number 1 Region: 8-96
Classification Level Classification E-value
Superfamily Sigma2 domain of RNA polymerase sigma factors 2.35e-23
Family Sigma2 domain of RNA polymerase sigma factors 0.0011
Further Details:      
 
Domain Number 2 Region: 106-188
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.00000000000000262
Family Sigma4 domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014267635.1.98070
Sequence length 214
Comment ECF subfamily RNA polymerase sigma-24 subunit [Granulicella mallensis]; AA=GCF_000178955.2; RF=representative genome; TAX=682795; STAX=940614; NAME=Granulicella mallensis MP5ACTX8; strain=MP5ACTX8; AL=Complete Genome; RT=Major
Sequence
MRADLSSPENFEALVREHQGLVFRTLTRMTGGGPHVEDLAQEAFFRLYRALPDFRGDATI
STYLYRIVVNLAQDEWKRRRKERTHLASEPLSPEGEEESSGWIENFAGDSLASEHARTPE
QRLSDAEMQSAVDAELLALPEIERSVLVLYHQEECSYEGIAVALGLPINTVRTHLHRGRK
RLSERLRSRLAVQPHPKEGSSNGPATGAIMAGKV
Download sequence
Identical sequences G8NUZ4
WP_014267635.1.98070 gi|374313364|ref|YP_005059794.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]