SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014285951.1.37980 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014285951.1.37980
Domain Number 1 Region: 16-179
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.45e-53
Family NQO2-like 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014285951.1.37980
Sequence length 266
Comment NADH-quinone oxidoreductase subunit E [Pseudovibrio sp. FO-BEG1]; AA=GCF_000236645.1; RF=na; TAX=911045; STAX=911045; NAME=Pseudovibrio sp. FO-BEG1; strain=FO-BEG1; AL=Chromosome; RT=Major
Sequence
MSVRRLHHEQPESFEFSPENLEWAKKVIERYPEGRQASAVVPILWRAQEQVGWVTEPAIR
VISEMLDMPRIRVLEVATFYTMFQLQPVGKKAHIQVCGTTPCQLRGSEELIKVCKSKISE
TPHTLSEDGNFSWEEVECLGACVNAPMVQIFKDFYEDLDVEKFEKLLDDIAGGKPVLPGP
QGVDRIFAAPEGGPTTLLNIEDTTKGAPQEAVIVDGSDAASKHHAGAALNTGGAGYTGVP
RPAEAGVAEFVERHRKAQEAKAKGEG
Download sequence
Identical sequences G8PJS7
WP_014285951.1.37980 gi|374331779|ref|YP_005081963.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]