SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014374176.1.69969 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014374176.1.69969
Domain Number 1 Region: 39-235
Classification Level Classification E-value
Superfamily Sortase 1.03e-28
Family Sortase 0.012
Further Details:      
 
Weak hits

Sequence:  WP_014374176.1.69969
Domain Number - Region: 2-15
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0259
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014374176.1.69969
Sequence length 255
Comment class E sortase [Blastococcus saxobsidens]; AA=GCF_000284015.1; RF=representative genome; TAX=1146883; STAX=138336; NAME=Blastococcus saxobsidens DD2; strain=DD2; AL=Complete Genome; RT=Major
Sequence
MPPPPPPPPAVRPAPGRWRAVAQGTGELLVTGGLVVLLFVGYEVYVTDLLTERRQDQLSV
ELHERWEEDAPAEAGLVQVEIGDAFGVLRIPRLGEDYARVILEGTTEAELSQGPGHYAGT
AMPGEPGNVALAGHRVGKGSPFLELDLVQPGDPIVVETADSWFVYRVLGNAATGNVDTDP
SGIPGRHIVRPETIEVISPTPNASADAAPTGAYLTLTTCHPRFSARQRLIVHARLDGAGI
PKAEMPDGPPALRES
Download sequence
Identical sequences H6RM17
gi|379733803|ref|YP_005327308.1| WP_014374176.1.69969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]