SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014405878.1.51978 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014405878.1.51978
Domain Number 1 Region: 3-130
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 7.33e-22
Family Terpene synthases 0.0039
Further Details:      
 
Domain Number 2 Region: 70-256
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.000000000017
Family Terpene synthases 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014405878.1.51978
Sequence length 262
Comment hypothetical protein [Methanocella conradii]; AA=GCF_000251105.1; RF=representative genome; TAX=1041930; STAX=1175444; NAME=Methanocella conradii HZ254; strain=HZ254; AL=Complete Genome; RT=Major
Sequence
MDTLEKAIKFLMGSQRADGSWGNGDPFVCARVMLALKDDAPEGMLLKGLKYLEGRQETDG
HFKPVGGMYSDATSTAYALIVLNKFDYGKASLPVSRGIVWLVESQNKDGSWGKNKEKKAY
TTTFCLRALHAFYLSGINRFARGLEFSLGYLRGLDFSREPVSHVYAPILNLYRMSYLDEG
LRDKFFEFALDAAEPALEGGSVADVAYLLGTLKALGEADVSAALEEWLAAAQHDDGSFGK
DLASPGDPNWTALVALAIKGML
Download sequence
Identical sequences H8I9J6
gi|383319718|ref|YP_005380559.1| WP_014405878.1.51978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]