SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014412868.1.98329 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014412868.1.98329
Domain Number 1 Region: 196-355
Classification Level Classification E-value
Superfamily RalF, C-terminal domain 1.23e-64
Family RalF, C-terminal domain 0.0000347
Further Details:      
 
Domain Number 2 Region: 8-192
Classification Level Classification E-value
Superfamily Sec7 domain 2.75e-54
Family Sec7 domain 0.00000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014412868.1.98329
Sequence length 646
Comment hypothetical protein [Rickettsia australis]; AA=GCF_000273745.1; RF=na; TAX=1196662; STAX=787; NAME=Rickettsia australis str. Phillips; strain=Phillips; AL=Contig; RT=Major
Sequence
MDSLVKNAVMKLFNDKPKSGIVRIKQWCADNNKDFAEETAKFFYEEKSNLNLECVGDYLG
TDGGDNKKVLESFTKQFNFKEKDYLESLRGFLQSFKLPGEAQKIDRLVESFGTNYYEQNL
NGEIKSKDAAYILAYQTIMLNTDLHNPSIAEPKKMTLEQLKNNLKGTNESQNFNDNFLKK
IYAGIKAKPFVLNFVDSSPGYEIDNISSQNDQTFKKLNKFLKETRNIQDSFSKLQNNNLT
AEFKNPKTLLNKFTGYEGSVIVKDEKGGKAAIQVYTPSVFSRWFLGEKSKIIIQPLSEEG
KQPSEQSLKLAAQITASFDTKVTSIKATYDYLKEDLKSRYENIINPKQELERASSIAELH
KNIKEITAIVQQTNQQIPEKPLASKESFEDLTQAEIGIKPVEILIKSSSQPVEKPKFNSF
IEELAWKSVQRKQNIDTPISQNKEPKIQTDNHAKILEELKQKQKELEDKKKGLEEKKSNS
NITREERWKIVAELESINNQFKAIEKVYNTINSAADREKKFDNKNNPASPTKGEPTAADL
QQQGALAAIKRMKEEKIKQQQAEAVNQSSKNTPTMPSGTIPVPPPMPGSGLPVSPPPPSI
PNIVKKEAKDIGKQIPQEGDKHKEGLAKAMEAQRKKIEQQNSGRGM
Download sequence
Identical sequences H8K7V1
WP_014412868.1.17962 WP_014412868.1.98329 gi|383501828|ref|YP_005415187.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]