SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014446122.1.27 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014446122.1.27
Domain Number 1 Region: 161-390
Classification Level Classification E-value
Superfamily Lysozyme-like 4.5e-84
Family Chitosanase 0.0000000862
Further Details:      
 
Domain Number 2 Region: 38-153
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.92e-37
Family Ricin B-like 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014446122.1.27
Sequence length 391
Comment glycoside hydrolase [Actinoplanes missouriensis]; AA=GCF_000284295.1; RF=representative genome; TAX=512565; STAX=1866; NAME=Actinoplanes missouriensis 431; strain=431; AL=Complete Genome; RT=Major
Sequence
MSRVKTVVYALSGLVLTSAATVYGLLPAGAATAGPIKGLGSKCIDVAGAATANGTAVQLY
DCNNSAAQQWTADGTLQALGKCLDVTAAGTTNGTKIQLYECNGTGAQNWTLTGGALVNPA
SGKCLDVTGGSTANGTRLQIWTCTGGAGQAWTLPGSAGTGKNLDDPAKKDVAMQIVSAAE
NSSLNWRAQFSYIEDINDGRGYTAGIIGFCSGTGDMLELVEAYTAASPSNVLAKYLPALR
SVNGTASHAGLDPNFTRDWRTAAADPAFQAAQEAERDRVYFNPSVRDGKADGVRALGQFA
YYDAAVVHGYSGMRSIRSRALAKAKPPAQGGDERAWLTAFLNERVIEMKKEPAHEDVTRI
DTAQRVFLNNGNFDLNTPLDFKVYGDSFHIS
Download sequence
Identical sequences I0HDZ8
gi|383781184|ref|YP_005465751.1| WP_014446122.1.27

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]