SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014470524.1.80835 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014470524.1.80835
Domain Number 1 Region: 8-72
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000222
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014470524.1.80835
Sequence length 73
Comment MULTISPECIES: SMI1/KNR4 family protein [Bacillus subtilis group]; AA=GCF_001587435.1; RF=na; TAX=1390; STAX=1390; NAME=Bacillus amyloliquefaciens; strain=B425; AL=Scaffold; RT=Major
Sequence
MDDKDFDVKSMTVAYEEQMPDWIIPIADADGGDQICLGVKEEATGKVYFLDHEMTDGVKD
TFLVANSFSDFMV
Download sequence
Identical sequences A0A0A0TVN4 A0A1Y0XA58
gi|384168894|ref|YP_005550272.1| gi|384163673|ref|YP_005545052.1| gi|384159828|ref|YP_005541901.1| WP_014470524.1.1127 WP_014470524.1.1325 WP_014470524.1.33972 WP_014470524.1.54561 WP_014470524.1.65712 WP_014470524.1.70207 WP_014470524.1.70510 WP_014470524.1.80835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]