SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014586589.1.3402 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014586589.1.3402
Domain Number 1 Region: 87-391
Classification Level Classification E-value
Superfamily "Helical backbone" metal receptor 1.53e-45
Family TM0189-like 0.084
Further Details:      
 
Weak hits

Sequence:  WP_014586589.1.3402
Domain Number - Region: 25-81
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000128
Family Type I dockerin domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014586589.1.3402
Sequence length 425
Comment ABC transporter substrate-binding protein [Methanosaeta harundinacea]; AA=GCF_000235565.1; RF=representative genome; TAX=1110509; STAX=301375; NAME=Methanosaeta harundinacea 6Ac; strain=6Ac; AL=Complete Genome; RT=Major
Sequence
MKGKMLASILALCLMVGISAADFTLHIYGNANMDDVIDERDIEYARGIIDGTERMTDLAD
VNGDGNVDEEDIRLTEEIIDGTAAEIKVIDSDGNSVSVKVPVERIVIYNHQCAEILQILN
ADDRVAGVRDTFETQENRFPQISKKKNIGSGVDLDIEAIISVDPDLIIAYTFYPTKEDLE
AELPSKIPILRIDCAGGGPCGIDSIRDGVSILGYLLDARDEAARYQEWHDRYVGPVEART
SAIPEGERVRVYLESTPEGSETISSRTAIGKNHPAGNLIELAGGVNIAAGHLPLYMDTDN
EYGEIETEWVLEENPEVIVGRAMGAGVRPYENEDDSLLRAYSDQIKGLPGFDGVDAVKND
RVYIITNDHAVTPNYPSALLLLAKWFYPEIFQDLNPREAHLEYLEMMGISKEVASKNTYY
YPAVA
Download sequence
Identical sequences G7WM29
WP_014586589.1.3402 gi|386001728|ref|YP_005920027.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]