SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014665641.1.91225 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014665641.1.91225
Domain Number 1 Region: 27-121
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000379
Family SMI1/KNR4-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014665641.1.91225
Sequence length 183
Comment hypothetical protein [Bacillus sp. JS]; AA=GCF_000259365.1; RF=na; TAX=1127744; STAX=1127744; NAME=Bacillus sp. JS; strain=JS; AL=Complete Genome; RT=Major
Sequence
MLLPEEFNRNWDVNKNGPLLKFPYDDLIEVPFSEDFKQFLSIGGLPETPPPYLDFTSSQT
SFKPITSIFDMSEAFQKYWLLGSTGSGDPVCIVESNERIVYLDNGNEYKEVFINSSINQF
AECILLFSEMIDKAIHINGEDAFIDNDIPEDVIEWLKEELKRVDSNCTREGSFWGTEIEN
LYE
Download sequence
Identical sequences I0F9Q5
WP_014665641.1.91225 gi|386760250|ref|YP_006233467.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]