SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014669108.1.57224 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014669108.1.57224
Domain Number 1 Region: 82-350
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.67e-22
Family Extended AAA-ATPase domain 0.054
Further Details:      
 
Domain Number 2 Region: 577-725
Classification Level Classification E-value
Superfamily TPR-like 1.73e-16
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 
Domain Number 3 Region: 3-63
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000697
Family Probable transcriptional regulator VC1968, N-terminal domain 0.043
Further Details:      
 
Weak hits

Sequence:  WP_014669108.1.57224
Domain Number - Region: 338-403
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000141
Family Plant O-methyltransferase, N-terminal domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014669108.1.57224
Sequence length 751
Comment transcriptional regulator [Streptomyces hygroscopicus]; AA=GCF_000340845.1; RF=na; TAX=1203460; STAX=1912; NAME=Streptomyces hygroscopicus subsp. jinggangensis TL01; AL=Complete Genome; RT=Major
Sequence
MDKAEFGRLLRAARQRALLTLESLAEASGVSVRAISDMERGQSLPRQATLSELMDALELD
EDERRRFVEAAMRRTEQIPRQLPPDLATFRGRTEALTAVHRLTSHVAGRGAHVVISAIGG
MAGVGKTALAVHWAHQVADRFPDGQLYVNLRGFEDSGRPLDPGAALAGFLDALGVPRSSI
PPGTEERAALFRERAASRRLIVVLDNARDEEQVRPLLPASAGCLTIVTSRSQLSGLAVAE
GATLVGLDVWSREEALAALAARIGEERCRAEPRAAAELVELCGFLPLAVAIVGAQVSASP
QVPLGPVVRELRDSRTRLDALASGDRRVDVRAVFSWSYRALTPGTARFFRHLALHPGPSV
SAEAAASLADVGTAAARRHLRELISANLVSRDAEGLYVLHDLVRAYGAELVERERDDRLG
AESRLLDYLRYNAHWANRLLGRSVSDSVGPPADGVVRVPLDTREEALVWFRQEESAVAAA
LRSLEDPRLLRFRMNLTQDWVTYYSVTGRWTEEIETKRIGLDAALRLDEPAAIARNAADL
ARALAETGRLDEADRQVELLLGLLDRLDPVDRAATERSIGWVRGRQQRHAEALHHARRAL
EIYRAQGDEGTTAREMNAVGWYLALLGRYEETIALCEEAVPLLRRHGNLRIEAAARDTMG
YARQRLGDLDAAVADYQESLRLYGEAFDGYNQAEVLDHLATAQKERGDRAGARESWLRAA
DLLNAIHSPRAERMRANAHALDTATTPTEQT
Download sequence
Identical sequences H2JLD3
gi|386836575|ref|YP_006241633.1| gi|474978850|ref|YP_007689316.1| WP_014669108.1.21199 WP_014669108.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]