SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014669442.1.57224 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014669442.1.57224
Domain Number 1 Region: 302-569
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.84e-26
Family Extended AAA-ATPase domain 0.032
Further Details:      
 
Domain Number 2 Region: 109-271
Classification Level Classification E-value
Superfamily TPR-like 6.32e-25
Family BTAD-like 0.0012
Further Details:      
 
Domain Number 3 Region: 736-941
Classification Level Classification E-value
Superfamily TPR-like 5.22e-20
Family CT2138-like 0.062
Further Details:      
 
Domain Number 4 Region: 14-107
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.000000000000207
Family PhoB-like 0.0014
Further Details:      
 
Weak hits

Sequence:  WP_014669442.1.57224
Domain Number - Region: 560-609
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0091
Family ArsR-like transcriptional regulators 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014669442.1.57224
Sequence length 974
Comment hypothetical protein [Streptomyces hygroscopicus]; AA=GCF_000340845.1; RF=na; TAX=1203460; STAX=1912; NAME=Streptomyces hygroscopicus subsp. jinggangensis TL01; AL=Complete Genome; RT=Major
Sequence
MTGLSRESADHAIQFSVLGPVRVWRGGGELLLGPKQQRLILAVLLARAGRPVSMHEFIDL
LWDGDPPSSATNAVHRYVGALRRLLEPDLPARSPGRWLARQAGGYLLRVDADCLDLLNFR
ALVDQARQADAAGDPTGSVGLFTTALDLWQGRCAADLEPVSSTRPAFVMLEHEYVSVVCE
AADTALRCRRAEAVLLPLRRAAERNPLDEALLARLLLVLASDGKQAEALAMYEEIRLRLA
EELSVDPGAELRAAHERILRHRFDAGAPAEAEEDEGAAYGPPVPAGSMPSPAPSPRTARP
AQLPPGLPGFTGREDALAQARALAARGGGALRVLAVDGIPGIGKTALAVHFAHQVASDFP
DGQLYADLRGFAPDGKPADPADILQGFLDALGVAPQRIPTSPDTRSALYRSVLADRRVLV
VLDNARDLAQIRPLLPGTGNCMVIVTSRSRLTALAAAHGAHLLTLDVPSPAEATNAFLER
VRASRPDATAREVRPLVERCGRLPLAVAIVAARAAAYPERTLHDIDLELSTTDHSLDGFS
DDNLDNDVRGVFSWSYRTLGPQAAHLFRLLPLHPGPDVTAAALASMAGISPHEAVQAMGE
LVRARLLTVRARNRYRAHDLILAYAAELAAQYERDRPAVRSRMYDHYRQTAHAANLLLRP
GPQPASPAAPLPSVTPEPLADTATATAWYTRERAVLRSVVEAAAAHGDSRMAWELAVTLQ
MCQQRMGWWHDWAATMRAALAAARKAEDAEGMARTHHGLAGALHSLGDLPGALRHLEQAR
RRFEQLRSTTDLAHVLGNIGVVYSSQEDHVRALRHMEAALDLLCGPEPRHLRAATLSDTA
MTRVKLGDPEGALRLARTAVVMFRDLRDLNGEGLTLTIIGQVFRRRRDYARSASYYERGI
ELMRLAGNRGNVAEELMALGDVRLDARDVAGARRAWTDALRSLDDPELPLAARAREKLAL
LDTVEEQREAASVI
Download sequence
Identical sequences H2JTJ3
gi|474979184|ref|YP_007689650.1| gi|386836909|ref|YP_006241967.1| WP_014669442.1.21199 WP_014669442.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]