SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014669481.1.21199 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014669481.1.21199
Domain Number 1 Region: 836-895
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.0000000000000303
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0065
Further Details:      
 
Domain Number 2 Region: 2-87,123-224
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000533
Family Extended AAA-ATPase domain 0.049
Further Details:      
 
Weak hits

Sequence:  WP_014669481.1.21199
Domain Number - Region: 371-401,739-812
Classification Level Classification E-value
Superfamily TPR-like 0.0242
Family Tetratricopeptide repeat (TPR) 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014669481.1.21199
Sequence length 907
Comment helix-turn-helix transcriptional regulator [Streptomyces hygroscopicus]; AA=GCF_000245355.1; RF=na; TAX=1133850; STAX=1912; NAME=Streptomyces hygroscopicus subsp. jinggangensis 5008; strain=5008; AL=Complete Genome; RT=Major
Sequence
MGRTSELRALEAVLDAGKAEGEALLLLGDPGVGKTVLLDAVATAARANGAHVLRVVGVEA
EEDLAFSALHQLLYPLLDQLPGIPAFQAGVLEQALSIRQGSAPGRFAISAAALALLQAAA
GREPLCVVVDDVHWIDRSSAEVLMFVARRLGGCRVAFVMAARSGWSGFVDPTGLPVLAVP
PLKPQDARMLLERSHPGLAESARQRILDEAEGNPLALIELPEQLKPAQRQGREPLPANLP
LSSRLESVFADRVLLLTPATRFFLLLVALDGQRRGNVRQIRAALRAAGEPWDDTLLEDGE
RSGLLRIDHMEDRVSFRHPMARSCLVHMSPSGRRKAAHRALAAVMDDTSERRAWHLAHAA
EGPDEAVALELTRAAQRALARGGATEAAAAFRRAAELSPDGKARARRLDEAAFAAGVSGQ
LATASELVTAGSAETLRGAAAAAYVLFHRDGDVDAVFHTLLPALNEAPYSTRPDDLAAYD
DAFYVLLNSAVWANRPDLWPPVERVLDRVSDIARMCFDCVADPARTAHDVRERLDRATAA
LSPHTPFWRVNWLIYTALYLDAFSYYDNVWRDFVGQAAYDSQRFVLLARAHDAFMRGDWD
TTLVIATEGTGDAAEHEYNFTHMMFTYGLASVAAGRGDEEALRRHGDAITAWAGPRRVRL
LLAAVAETRVTTAMGRGDFEEAYQQAVSLTPPGQLPAYYPHVQRVFLDLVESAVRTGRTA
DARAHVEAGRQARLGAISPHHEIILAVAAAVAAADEDAGELYEAALAVPDASLWAYEYAR
LRLLYGEWLRRRRDYTASRVHLGVALDLFEHRLKAPLWAKRAREELRAAGVGVPVPQGTA
AVPMSAQERRIAELAAGGLSNKEIGRRLNISPRTAGAHLYRVFPKLGITSRAALRDALAA
LDQRQAR
Download sequence
Identical sequences H2JTN4
gi|474979225|ref|YP_007689691.1| gi|386836950|ref|YP_006242008.1| WP_014669481.1.21199 WP_014669481.1.57224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]