SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014669537.1.21199 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014669537.1.21199
Domain Number 1 Region: 855-1142
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.59e-65
Family WD40-repeat 0.0000688
Further Details:      
 
Domain Number 2 Region: 460-749
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.86e-64
Family WD40-repeat 0.0000946
Further Details:      
 
Domain Number 3 Region: 22-311
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.61e-55
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 4 Region: 331-433
Classification Level Classification E-value
Superfamily TPR-like 0.0000000127
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014669537.1.21199
Sequence length 1266
Comment protein kinase [Streptomyces hygroscopicus]; AA=GCF_000245355.1; RF=na; TAX=1133850; STAX=1912; NAME=Streptomyces hygroscopicus subsp. jinggangensis 5008; strain=5008; AL=Complete Genome; RT=Major
Sequence
MRQGAAAAVGEWRDWRVGDRVLGVYEVTGALGQGGMGRVHRVRHLGWGTDLAVKSPRPEL
FRDEADQERFVREAETWVGLELHPHLCGCHYVRTIGGVPRVFAEYVDGGSLRESIDDGRL
YRGARDEVVGRILDIAVQMARGLAHAHLSGVVHQDVKPGNVLLDRRGTAKITDFGLARAR
HFGTRPTPSDRVADGAAPGGAALDAATLLVTHGGMTPAYASPEQVRGAPLSRRTDVWSFA
VSVLEMFTGAVTWGVGSAAGAALAAYRLSPPPDAPVASMPGALADLLERCLRERVEERPD
DLAAVAGELAEVYAREVARPYPRRAENAAVHRADGLNNRAMSLLDLGRTREAEAALAEAH
AADPQHPQATYNLGLLRWRSGTLADDALVDRMESARASAEGPSPADHLLAHVHLERGDHE
SALPLLRAASATAEATADADAGTAPRDALAHAEREHAAGGRLLATFTGHRAVVHAVSLSA
DGSRALSGDDAGDVRLWDTATGRPRALKGHRAAVHAVSLSPDGRLALTGGHDGDVRLWDT
GTGRCLRRLSGHTGSVRAARLAPDGSTALTGGWDGTLRWWDVATGRCLRVVDSPEGPGGA
GREVNAACLSADGRLALFVGGRTVLWDLVEDRRVRTLDRGTIWPAALSHDRRYALTGGGD
RALEWWDLATGRPLRTLRADARPPWTAELSADGRFAVTGAIGGTLRWWELATGRCLRTYD
AHFSQVTSVSLSGDGRRVLTGGDHRVRLWQLPAPDAYTAPFRICRPRSHTELTRYDDRVA
ALLDDAESAAGRQRYADALALVTEARALPGHERDTRALAAWHRLSLVTVRTGVRGAWPAG
TVELSTNGTQAHATADGRRALCADLGTLRLWDFEDGGRCVRTFDGHEGAVEAVSLSADER
LALSGGEDGTVRLWDVRTGRCLSVLTGHGAKVRSVSFSGDGRFAFSGGEDGSVRWWELAT
GRMLRAYEYGGQGVYSVCPSADGRFLLSCGEGGRARLWELDSGHRVRTFEDLDRDAVTDS
PLLGILHSARLTADGRHAVTANGDGRVALWDVAAGRCLHVFEEHVGSDGHAEPMTSVSLS
TDGRFALAANWDTTVRLLDLRAGRCLRTLGGHRRWVLSVHLSADGRYAVSTGTDRTLRRW
ELDWELEAREPADWDEGARPHLEAFLAAHTPFGRPVPHGLQSVSYDPRLARHGRPVWSEA
DADLLLRHLARAGYGWLRAAGVRAELERMAAAWQGPRPLPAPRPGPTGLLSSARHRYRAW
RGRPRS
Download sequence
Identical sequences H2JUZ2
gi|474979281|ref|YP_007689747.1| WP_014669537.1.21199 WP_014669537.1.57224 gi|386837006|ref|YP_006242064.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]