SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014670145.1.57224 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014670145.1.57224
Domain Number 1 Region: 57-141
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000129
Family BTAD-like 0.0057
Further Details:      
 
Domain Number 2 Region: 4-79
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.0000000000258
Family PhoB-like 0.00095
Further Details:      
 
Domain Number 3 Region: 153-212
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000651
Family G proteins 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014670145.1.57224
Sequence length 229
Comment hypothetical protein [Streptomyces hygroscopicus]; AA=GCF_000340845.1; RF=na; TAX=1203460; STAX=1912; NAME=Streptomyces hygroscopicus subsp. jinggangensis TL01; AL=Complete Genome; RT=Major
Sequence
MVVEFSLLGTIEARLDGRPADVGHMRQRCVLAALLLDVNKAVSVDALVDRVWGDRPPQRV
RGTLYGYLSRLRQALAQAPEVIMLALYRAGGAADALSCYEDIRRRLAHELGADPGPPLRG
LHQQILANDPALALHETATERLSAGAATTSPVPRQLLAPPAHFVGRDAELAVLDKMLASQ
AEPRTTMPLAVICGTGGVGKTWLALRWAHSRNVGKLAQSNCSAYDPKPT
Download sequence
Identical sequences H2K6R6
gi|474979894|ref|YP_007690360.1| WP_014670145.1.21199 WP_014670145.1.57224 gi|386837620|ref|YP_006242678.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]