SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014670343.1.21199 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014670343.1.21199
Domain Number 1 Region: 13-246
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.72e-20
Family RecA protein-like (ATPase-domain) 0.051
Further Details:      
 
Domain Number 2 Region: 702-767
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 1.26e-18
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0024
Further Details:      
 
Weak hits

Sequence:  WP_014670343.1.21199
Domain Number - Region: 494-626
Classification Level Classification E-value
Superfamily TPR-like 0.000626
Family Tetratricopeptide repeat (TPR) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014670343.1.21199
Sequence length 774
Comment LuxR family transcriptional regulator [Streptomyces hygroscopicus]; AA=GCF_000245355.1; RF=na; TAX=1133850; STAX=1912; NAME=Streptomyces hygroscopicus subsp. jinggangensis 5008; strain=5008; AL=Complete Genome; RT=Major
Sequence
MGAFVGLGGELTSLIGRRTETARIARLLSGARLVTLSGVGGVGKTRLALRVAADAARSAF
PDGVYVAELATLRDPEQLAASVLGTLDVANPGRPGADATAALVARLCERRALLVLDNCEH
LIDACARLADALLRAAPGLRVLATSRQPLGIAGEHVFPVEPLPVPAADQGHGVRALSDNP
AVALFTDRAAAVLPGFTVTESDAAAVAELVRRLDGLPFAIELAAARIRSLTPHEILERLT
DRFALLTGGSRVAADRQRTLRALIDWSHELCTERERLLWARASVFRGGFDLESLERVCAD
AELPPAALLDTLDALVVKSIVNCRHESGRARYHMLETVREYGHERLAASGSLDAIRRRHR
DRYAELTARAGQEWFGPRQVDWFTRLRLDHPNLRAALEFCLERPGQARAGLALAVSPRHY
WITAGLLSEGRRWLSRLLAADHAQHHGDDAAGPDAALRVQAQVTDTYLGMLQGDPESGVR
RALATCEAAARRGGHRRESAWVGHHHGILAIWNEDFADAAELFARARAEFRAQGCLDAAL
ECRVKFAIAHAYGGDVAAADEACGEVEAAARAHDESWLHGMALLARALLARRADAPVDAI
NNARAAIARLRPFHDWWDVAMCVEVIAWSTQDAPRRAARLLGVLHMLWESVGGRLGSAPF
MRAQHVRFEAAVREALPTAAFDREFRRGARATVEEAMAYVLDDVAGVPGLTRRESQVAEL
VAEGLTNKDIAARLTIAQRTAENHVERILGKLGFTSRTQLAVWAYERRAEPAGS
Download sequence
Identical sequences H2JLG1
gi|474980027|ref|YP_007690493.1| WP_014670343.1.21199 WP_014670343.1.57224 gi|386837818|ref|YP_006242876.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]